PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00834-abinit-gene-0.1-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family NF-YB
Protein Properties Length: 209aa    MW: 21746.9 Da    PI: 7.0587
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00834-abinit-gene-0.1-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1862.7e-5824119297
                                                 NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrek 58 
                                                           reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrek
  augustus_masked-scaffold00834-abinit-gene-0.1-mRNA-1  24 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREK 80 
                                                           89******************************************************* PP

                                                 NF-YB  59 rktingddllwalatlGfedyveplkvylkkyrelegek 97 
                                                           rktingddllwa++tlGfedyveplkvyl+++re+egek
  augustus_masked-scaffold00834-abinit-gene-0.1-mRNA-1  81 RKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREMEGEK 119
                                                           *************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-5419128IPR009072Histone-fold
SuperFamilySSF471131.55E-4026128IPR009072Histone-fold
PfamPF008086.4E-282993IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-205775No hitNo description
PROSITE patternPS0068506076IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-207694No hitNo description
PRINTSPR006151.2E-2095113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MADSDNDSGG RGGGSGSANE QSPREQDRFL PIANVSRIMK KALPANAKIS KDAKETVQEC  60
VSEFISFITG EASDKCQREK RKTINGDDLL WAMTTLGFED YVEPLKVYLQ RFREMEGEKT  120
VAAREKDGPG GASSVSVSVG LGNGSDVYGV SSGGTSSGMG MMIHQGHVYG SGGFHHMSGG  180
GGGGGGNSNS GGLSGHNYAG LRSNTGRSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-4824114292Transcription factor HapC (Eurofung)
4g91_B2e-4824114292Transcription factor HapC (Eurofung)
4csr_A2e-4822114294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-4822114294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A2e-4822114193NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4860284e-94AM486028.2 Vitis vinifera contig VV78X047419.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523242.11e-93PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233101e-74NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0R0F8V13e-93A0A0R0F8V1_SOYBN; Uncharacterized protein
STRINGGLYMA18G08620.18e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-68nuclear factor Y, subunit B3